PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G31620.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 253aa    MW: 29212.4 Da    PI: 9.3233
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G31620.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.2e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyey++
  OMERI03G31620.2  9 KRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYAT 59
                     79***********************************************86 PP

2K-box105.94.8e-3579171597
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                         s+e+ ++ ++++e++kLk+++e++q+ q+hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++l+le+i+elq+kek+lqeenk L+k+
  OMERI03G31620.2  79 VLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKE 171
                      55567788899******************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.941161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-34286IPR002100Transcription factor, MADS-box
CDDcd002652.99E-41276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014864.3E-3084171IPR002487Transcription factor, K-box
PROSITE profilePS5129717.55688185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KANEISVLCD AEVALIIFST KGKLYEYATD  60
SCMDKILERY ERYSYAEKVL ISAESDTQGN WCHEYRKLKA KVETIQKCQK HLMGEDLESL  120
NLKELQQLEQ QLENSLKHIR SRKSQLMLES INELQRKEKS LQEENKVLQK ENPCSFLQLV  180
EKQKVQKQQV QWDQTQPQTS SSSSSFMMRE ALPTTNISNY PAAAGERIED VAAGQPQHVR  240
IGLPPWMLSH ING
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q4e-22174173Myocyte-specific enhancer factor 2B
1tqe_R4e-22174173Myocyte-specific enhancer factor 2B
1tqe_S4e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519160.0AY551916.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS211 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631033.10.0PREDICTED: MADS-box transcription factor 14 isoform X1
SwissprotQ10CQ11e-158MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLA0A0E0D6X70.0A0A0E0D6X7_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g54160.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-76MIKC_MADS family protein